PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10000473
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family GRF
Protein Properties Length: 415aa    MW: 46639.1 Da    PI: 9.2516
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10000473genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC78.56.5e-2591134144
          WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                  d+epgrCrRtDGKkWRCs+++++++k+CErH+hrg++rsrk++e
  Lus10000473  91 DPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRKPVE 134
                  79***************************************997 PP

2QLQ606.8e-211146237
          QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                 +FTa+Q+q+L++Q+l++Ky+a++ P+P++Ll+ai++
  Lus10000473 11 PFTATQWQELEHQALIFKYMASGIPIPHDLLFAIKR 46
                 8*********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.1E-121046IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.5E-151144IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.6371146IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.9891135IPR014977WRC domain
PfamPF088791.5E-2092134IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009739Biological Processresponse to gibberellin
GO:0030912Biological Processresponse to deep water
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 415 aa     Download sequence    Send to blast
MMSGRSSSRF PFTATQWQEL EHQALIFKYM ASGIPIPHDL LFAIKRSSSS SSSSSSCLDS  60
SSSLLSSKLF PSQSPHIGWS CFQLGLGRKI DPEPGRCRRT DGKKWRCSKE AYPDSKYCER  120
HMHRGKNRSR KPVEVAATQQ QSPITPLTAK NSSSPSLLQY PHTSLSLLSS SSSTTTDHHY  180
KHPPPPSGSY NNYHHHQFLS SSSHAAARPQ QPNDSTNLLL DSAGYYSLSN TDYRRNRSIY  240
GLKEEVDEHA FFSETSGSIR NSEEAWRLSP LAINSSSSSS SSFSSSKQRS SSHQHQHHHQ  300
ESQNQNQNDY SNSLQLQSSD NIDSCTKNQN SGCYLDAAKS SQSMMRFDRV VNNDPQKRVH  360
RFFDEWPLRN KESASWLQLD DKSFNNTTLS ISIPNSTSMD LPIFGSRTSY HQQH*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4680354e-43AM468035.1 Vitis vinifera contig VV78X155042.5, whole genome shotgun sequence.
GenBankAP0098464e-43AP009846.1 Lotus japonicus genomic DNA, clone: LjT02E24, TM1624a, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006381639.11e-122hypothetical protein POPTR_0006s14560g
TrEMBLU5GAT51e-122U5GAT5_POPTR; Uncharacterized protein
STRINGPOPTR_0006s14560.11e-120(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40433459
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.14e-49growth-regulating factor 5